Zorky CRMZorky CRM
EN|RU
@ekaterinovikova
Все вакансии

Creative Strategist

leadremoteCalifornia, California, United States, USСкор undefined/1001нед назад
Стек
execeducationstrategycustomer supportcopywritingmarketingtravelspeechvideomobile
Откликнуться
Загрузите резюме — мы свяжем вас с работодателем напрямую через нашу базу.
Отправить резюме →
Описание
We started three years ago as a passion project because we wanted better instant ramen toppings and couldn’t find anything like it. Since then, we’ve gone viral, built a loyal fan base, grown to over 400,000 customers, and recently launched protein ramen. We’re a small, fast-moving team of builders who take ownership, move quickly, and figure things out as we go. This person will own performance-driven creative across paid social, with Meta currently being our largest channel. This role sits at the intersection of performance marketing, creative strategy, consumer psychology, and execution. This is a high-impact role with significant room for leadership and growth. • Develop creative angles based on customer pain points, product benefits, tren
Контакты работодателя (email/phone/telegram) скрыты из публичного превью — отправьте резюме, чтобы мы связали вас напрямую.
Срочный вопрос? Напишите @ekaterinovikova