Zorky CRMZorky CRM
EN|RU
@ekaterinovikova
All jobs

Creative Strategist

leadremoteCalifornia, California, United States, USScore undefined/1001w ago
Stack
execeducationstrategycustomer supportcopywritingmarketingtravelspeechvideomobile
Apply
Upload your CV — we will connect you with the employer directly through our pool.
Send your CV →
Description
We started three years ago as a passion project because we wanted better instant ramen toppings and couldn’t find anything like it. Since then, we’ve gone viral, built a loyal fan base, grown to over 400,000 customers, and recently launched protein ramen. We’re a small, fast-moving team of builders who take ownership, move quickly, and figure things out as we go. This person will own performance-driven creative across paid social, with Meta currently being our largest channel. This role sits at the intersection of performance marketing, creative strategy, consumer psychology, and execution. This is a high-impact role with significant room for leadership and growth. • Develop creative angles based on customer pain points, product benefits, tren
Employer contacts (email/phone/telegram) are hidden from the public preview — send your CV, and we will connect you directly.
Urgent question? Message @ekaterinovikova